HPA003230
Anti-PDIA3 antibody produced in rabbit
Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
Anti-58 kDa glucose-regulated protein antibody produced in rabbit, Anti-58 kDa microsomal protein antibody produced in rabbit, Anti-Disulfide isomerase ER-60 antibody produced in rabbit, Anti-ERp57 antibody produced in rabbit, Anti-ERp60 antibody produced in rabbit, Anti-Protein disulfide-isomerase A3 precursor antibody produced in rabbit, Anti-p58 antibody produced in rabbit
로그인조직 및 계약 가격 보기
모든 사진(10)
About This Item
추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
mouse, rat, human
향상된 검증
RNAi knockdown
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000
면역원 서열
PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PDIA3(2923)
유사한 제품을 찾으십니까? 방문 제품 비교 안내
일반 설명
PDIA3 (protein disulfide isomerase family A, member 3) is a multi-functional protein, which belongs to the protein-disulfide isomerase family. It is thought to be a membrane receptor for 1,25-dihydroxyvitamin D3 (1α,25(OH)2D3), and is localized to endoplasmic reticulum, nucleus, plasma membrane and extracellular matrix.
면역원
Protein disulfide-isomerase A3 precursor recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-PDIA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
PDIA3 (protein disulfide isomerase family A, member 3) is believed to be a membrane receptor for 1,25(OH)2D3 that stimulates rapid membrane responses through the vitamin D receptor. In the presence of Pdia3, 1,25(OH)2D3 stimulates prostaglandin E2, protein kinase C and other membrane signaling pathways during osteoblast maturation. It stimulates cellular response to chemotherapy-induced DNA damage. The protein functions as a disulfide isomerase protein that associates with lectin chaperones calreticulin and calnexin to mediate folding of glycoproteins. It is found to be secreted in the early stages of renal fibrosis.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST86567
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Natalia F Krynetskaia et al.
Molecular cancer therapeutics, 8(4), 864-872 (2009-04-18)
The identification of new molecular components of the DNA damage signaling cascade opens novel avenues to enhance the efficacy of chemotherapeutic drugs. High-mobility group protein 1 (HMGB1) is a DNA damage sensor responsive to the incorporation of nonnatural nucleosides into
Hassan Dihazi et al.
Journal of cell science, 126(Pt 16), 3649-3663 (2013-06-20)
Renal fibrosis is characterized by excessive accumulation of extracellular matrix (ECM), which compromises organ function by replacing normal organ tissue. The molecular mechanisms leading to renal fibrosis are not fully understood. Here we demonstrated that TGFβ1, AGT or PDGF stimulation
Annika Möller-Kerutt et al.
Life science alliance, 6(3) (2022-12-23)
Crumbs2 (CRB2) is a central component of the renal filtration barrier and part of the slit diaphragm, a unique cell contact formed by glomerular podocytes. Some CRB2 variants cause recessive inherited forms of steroid-resistant nephrotic syndrome. However, the disease-causing potential
Huixing Feng et al.
PloS one, 9(4), e95621-e95621 (2014-04-26)
Proteomics study was performed to investigate the specific protein expression profiles of HepG2 cells transfected with mutant HBV compared with wildtype HBV genome, aiming to identify the specific functions of SH3 binding domain (proline rich region) located in HBx. In
Jiaxuan Chen et al.
The Journal of biological chemistry, 285(47), 37041-37050 (2010-09-17)
Protein-disulfide isomerase-associated 3 (Pdia3) is a multifunctional protein hypothesized to be a membrane receptor for 1,25(OH)(2)D(3). In intestinal epithelium and chondrocytes, 1,25(OH)(2)D(3) stimulates rapid membrane responses that are different from genomic effects via the vitamin D receptor (VDR). In this
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.