AV47617

Anti-SETD2 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-FLJ16420, Anti-FLJ22472, Anti-FLJ23184, Anti-FLJ45883, Anti-HIF-1, Anti-HSPC069, Anti-HYPB, Anti-SET domain containing 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 항체 형태: IgG fraction of antiserum
• Quality Level: 100
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 97 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_054878
• UniProt 수납 번호: Q9BYW2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SETD2(29072)

설명

면역원

Synthetic peptide directed towards the N terminal region of human SETD2

생화학적/생리학적 작용

Huntington′s disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. SETD2 is a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs.

서열

Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable