추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
68 kDa
종 반응성
mouse, rat, rabbit, pig, human, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NR4A3(8013)
면역원
Synthetic peptide directed towards the middle region of human NR4A3
애플리케이션
Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
생화학적/생리학적 작용
Nuclear receptor subfamily 4, group A, member 3 (NR4A3; NOR1) is an orphan receptor belonging to the steroid-thyroid hormone-retinoid receptor superfamily. It binds the NGFI-B Response Element (NBRE) and acts as transcriptional activator. NR4A3 is a regulator of mast cell function, inflammation and insulin gene expression.
서열
Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Ankita Saini et al.
Scientific reports, 8(1), 2296-2296 (2018-02-06)
Mycobacterium tuberculosis instigates interactions with host factors to promote its survival within the host inimical conditions. Among such factors, nuclear receptors (NRs) seem to be promising candidates owing to their role in bacterial pathogenesis. However, only few members of NR
Gianni Garcia-Faroldi et al.
PloS one, 9(2), e89311-e89311 (2014-03-04)
Nuclear receptor 4a3 (Nr4a3) is a transcription factor implicated in various settings such as vascular biology and inflammation. We have recently shown that mast cells dramatically upregulate Nuclear receptor 4a3 upon activation, and here we investigated the functional impact of
Weina Gao et al.
PloS one, 9(3), e91462-e91462 (2014-03-19)
NR4A3/NOR-1 is a member of the NR4A orphan nuclear receptor subfamily, which contains early response genes that sense and respond to a variety of stimuli in the cellular environment. The role of NR4A3 in insulin expression in pancreatic beta cells
Takashi Nomiyama et al.
The Journal of biological chemistry, 281(44), 33467-33476 (2006-09-02)
Members of the nuclear hormone receptor superfamily function as key transcriptional regulators of inflammation and proliferation in cardiovascular diseases. In addition to the ligand-dependent peroxisome proliferator-activated receptors and liver X receptors, this family of transcription factors includes a large number
M Lappas
Placenta, 35(11), 866-875 (2014-09-10)
Members of the NR4A subfamily are involved in a wide range of diseases including obesity and diabetes. The aim of this study was to determine the effect of maternal obesity and gestational diabetes mellitus (GDM) on the expression of the
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.