콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV45646

Sigma-Aldrich

Anti-NR4A3 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-CHN, Anti-CSMF, Anti-MINOR, Anti-NOR1, Anti-Nuclear receptor subfamily 4, group A, member 3, Anti-TEC

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

68 kDa

종 반응성

mouse, rat, rabbit, pig, human, horse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... NR4A3(8013)

면역원

Synthetic peptide directed towards the middle region of human NR4A3

애플리케이션

Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

생화학적/생리학적 작용

Nuclear receptor subfamily 4, group A, member 3 (NR4A3; NOR1) is an orphan receptor belonging to the steroid-thyroid hormone-retinoid receptor superfamily. It binds the NGFI-B Response Element (NBRE) and acts as transcriptional activator. NR4A3 is a regulator of mast cell function, inflammation and insulin gene expression.

서열

Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ankita Saini et al.
Scientific reports, 8(1), 2296-2296 (2018-02-06)
Mycobacterium tuberculosis instigates interactions with host factors to promote its survival within the host inimical conditions. Among such factors, nuclear receptors (NRs) seem to be promising candidates owing to their role in bacterial pathogenesis. However, only few members of NR
Gianni Garcia-Faroldi et al.
PloS one, 9(2), e89311-e89311 (2014-03-04)
Nuclear receptor 4a3 (Nr4a3) is a transcription factor implicated in various settings such as vascular biology and inflammation. We have recently shown that mast cells dramatically upregulate Nuclear receptor 4a3 upon activation, and here we investigated the functional impact of
Weina Gao et al.
PloS one, 9(3), e91462-e91462 (2014-03-19)
NR4A3/NOR-1 is a member of the NR4A orphan nuclear receptor subfamily, which contains early response genes that sense and respond to a variety of stimuli in the cellular environment. The role of NR4A3 in insulin expression in pancreatic beta cells
Takashi Nomiyama et al.
The Journal of biological chemistry, 281(44), 33467-33476 (2006-09-02)
Members of the nuclear hormone receptor superfamily function as key transcriptional regulators of inflammation and proliferation in cardiovascular diseases. In addition to the ligand-dependent peroxisome proliferator-activated receptors and liver X receptors, this family of transcription factors includes a large number
M Lappas
Placenta, 35(11), 866-875 (2014-09-10)
Members of the NR4A subfamily are involved in a wide range of diseases including obesity and diabetes. The aim of this study was to determine the effect of maternal obesity and gestational diabetes mellitus (GDM) on the expression of the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.