AV38611

Anti-MyB antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Cmyb, Anti-Efg, Anti-c-myb, Anti-c-myb_CDS, Anti-v-Myb myeloblastosis viral oncogene homolog (avian)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 38 kDa
• 종 반응성: mouse, bovine, human, horse, dog, rabbit, guinea pig, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001123644
• UniProt 수납 번호: P10242
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MYB(4602)

설명

면역원

Synthetic peptide directed towards the N terminal region of human MYB

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

생화학적/생리학적 작용

MYB may be a transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

서열

Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable