추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
31 kDa
종 반응성
rat, human, bovine, horse, mouse, guinea pig, rabbit, dog
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PSME3(10197)
면역원
Synthetic peptide directed towards the N-terminal region of Human PSME3
애플리케이션
Anti-PSME3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
Proteasomes are protein complexes that facilitate the degradation of damaged proteins by proteolysis. Proteasomes are located throughout the eukaryotic cells but primarily localized in nucleus. They are composed of 2 complexes, a 20S core and a 19S regulator. The modified proteasome referred to as immunoproteasome contains an alternate regulator that is 11S regulator or PA28 against 19S regulator. PSME3 gene encodes the gamma subunit of the 11S regulator. REG-gamma (also known as PA28-gamma) stimulates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. REG-gamma interact with both MDM2 and p53 proteins and stimulates ubiquitination- and MDM2-dependent proteasomal degradation of p53 which in turn restricts its accumulation and inhibits apoptosis after DNA damage.
서열
Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
J M Peters et al.
The Journal of biological chemistry, 269(10), 7709-7718 (1994-03-11)
The 26 S proteolytic complex ("26 S proteasome") is a macromolecular assembly thought to be involved in ATP- and ubiquitin-dependent protein degradation in the cytoplasm of higher eukaryotic cells. This complex is composed of one 20 S cylinder particle (multicatalytic
Xiaolin Gao et al.
Archives of biochemistry and biophysics, 425(2), 158-164 (2004-04-28)
The proteasome activation properties of recombinant REG gamma molecules depend on purification procedures. Prior to ammonium sulfate precipitation recombinant REG gamma activates the trypsin-like catalytic subunit of the proteasome; afterwards it activates all three catalytic subunits. The expanded activation specificity
Zhuo Zhang et al.
The EMBO journal, 27(6), 852-864 (2008-03-01)
Downregulation of p53 by MDM2-mediated proteasomal degradation makes cells resistant to apoptosis. The MDM2-p53 interaction is well characterized, but the mechanisms that regulate the interaction are not well understood. Here, we show that PA28gamma, a proteasome activator that inhibits apoptosis
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.