콘텐츠로 건너뛰기
Merck
모든 사진(2)

Key Documents

AV46142

Sigma-Aldrich

Anti-PSME3 (AB1) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Ki, Anti-PA28-gamma, Anti-PA28G, Anti-Proteasome (prosome, macropain) activator subunit 3 (PA28 γ; Ki), Anti-REG-GAMMA

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

31 kDa

종 반응성

rat, human, bovine, horse, mouse, guinea pig, rabbit, dog

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PSME3(10197)

면역원

Synthetic peptide directed towards the N-terminal region of Human PSME3

애플리케이션

Anti-PSME3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

생화학적/생리학적 작용

Proteasomes are protein complexes that facilitate the degradation of damaged proteins by proteolysis. Proteasomes are located throughout the eukaryotic cells but primarily localized in nucleus. They are composed of 2 complexes, a 20S core and a 19S regulator. The modified proteasome referred to as immunoproteasome contains an alternate regulator that is 11S regulator or PA28 against 19S regulator. PSME3 gene encodes the gamma subunit of the 11S regulator. REG-gamma (also known as PA28-gamma) stimulates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. REG-gamma interact with both MDM2 and p53 proteins and stimulates ubiquitination- and MDM2-dependent proteasomal degradation of p53 which in turn restricts its accumulation and inhibits apoptosis after DNA damage.

서열

Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

J M Peters et al.
The Journal of biological chemistry, 269(10), 7709-7718 (1994-03-11)
The 26 S proteolytic complex ("26 S proteasome") is a macromolecular assembly thought to be involved in ATP- and ubiquitin-dependent protein degradation in the cytoplasm of higher eukaryotic cells. This complex is composed of one 20 S cylinder particle (multicatalytic
Xiaolin Gao et al.
Archives of biochemistry and biophysics, 425(2), 158-164 (2004-04-28)
The proteasome activation properties of recombinant REG gamma molecules depend on purification procedures. Prior to ammonium sulfate precipitation recombinant REG gamma activates the trypsin-like catalytic subunit of the proteasome; afterwards it activates all three catalytic subunits. The expanded activation specificity
Zhuo Zhang et al.
The EMBO journal, 27(6), 852-864 (2008-03-01)
Downregulation of p53 by MDM2-mediated proteasomal degradation makes cells resistant to apoptosis. The MDM2-p53 interaction is well characterized, but the mechanisms that regulate the interaction are not well understood. Here, we show that PA28gamma, a proteasome activator that inhibits apoptosis

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.