추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
90 kDa
종 반응성
rabbit, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... UHRF2(115426)
일반 설명
UHRF2 is a ubiquitin E3 ligase that also functions as a SUMO E3 ligase for ZNF131. This E3 ligase has been implicated in the cell cycle network.
Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.
Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.
면역원
Synthetic peptide directed towards the N terminal region of human UHRF2
애플리케이션
Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml and for IHC (4-8 μg/ml).
생화학적/생리학적 작용
UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
서열
Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Tsutomu Mori et al.
FEBS letters, 586(11), 1570-1583 (2012-06-08)
As predicted by systems biology, a paradigm shift will emerge through the integration of information about different layers of cellular processes. The cell cycle network is at the heart of the cellular computing system, and orchestrates versatile cellular functions. The
Yohan Oh et al.
The Journal of biological chemistry, 288(13), 9102-9111 (2013-02-14)
Small ubiquitin-like modifier (SUMO), a member of the ubiquitin-related protein family, is covalently conjugated to lysine residues of its substrates in a process referred to as SUMOylation. SUMOylation occurs through a series of enzymatic reactions analogous to that of the
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.