추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
78 kDa
종 반응성
human, mouse, rat
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ACSL1(2180)
관련 카테고리
일반 설명
ACSL1 is an isozyme that belongs to the long-chain fatty-acid-coenzyme A ligase family. This enzyme converts free long-chain fatty acids into fatty acyl-CoA esters. Thus, it regulates lipid synthesis and fatty acid breakdown. Studies in bovine mammary glands have reported that ACSL1 modulates the channelling of fatty acids towards milk fat formation.
Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1.
Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1.
면역원
Synthetic peptide directed towards the C terminal region of human ACSL1
애플리케이션
Rabbit Anti-ACSL1 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml.
생화학적/생리학적 작용
ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
서열
Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Massimo Bionaz et al.
The Journal of nutrition, 138(6), 1019-1024 (2008-05-22)
The lactating bovine mammary gland is a formidable triacylglycerol-synthesizing machine and, as such, represents an ideal model for studying putative functions of distinct isoforms of solute carrier family 27 transporters [(SLC27A) 1, 2, 3, 5, 6], long chain acyl-CoA synthetases
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.