추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
28 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MEOX1(4222)
일반 설명
MEOX1 is a homeobox transcription factor that regulates somite development. It is known to maintain sclerotome polarity and is also involved in axial skeleton formation. MEOX1 mutations have been linked to Klippel-Feil syndrome (KFS).
Rabbit Anti-MEOX1 bovine, canine, and human MEOX1.
Rabbit Anti-MEOX1 bovine, canine, and human MEOX1.
면역원
Synthetic peptide directed towards the N terminal region of human MEOX1
애플리케이션
Rabbit Anti-MEOX1 can be used for western blot applications at a concentration of 0.2-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
생화학적/생리학적 작용
MEOX1 belongs to a family of nonclustered, diverged homeobox genes. It may play a role in regulating growth and differentiation.
서열
Synthetic peptide located within the following region: YPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Mutation in MEOX1 gene causes a recessive Klippel-Feil syndrome subtype.
Bayrakli F, et al. et al.
BMC Genetics (2013)
Susan Skuntz et al.
Developmental biology, 332(2), 383-395 (2009-06-13)
Meox1 and Meox2 are two related homeodomain transcription factor genes that together are essential for the development of all somite compartments. Here we show that mice homozygous for Meox1 mutations alone have abnormalities that are restricted to the sclerotome and
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.