AV32263

Anti-ETV4 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Ets variant gene 4 (E1A enhancer binding protein, E1AF)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 54 kDa
• 종 반응성: mouse, rat, human, pig, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_001073143
• UniProt 수납 번호: P43268
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ETV4(2118)

설명

일반 설명

ETS variant gene 4 (ETV4, E1AF) is a transcription factor that regulates cell motility and invasiveness. It confers an invasive (metastatic) phenotype on various cancer cells via activation of genes such involved in cell mobilization such as HER2/neu and various matrix metalloproteinases. ETV4/E1AR activates the Rho/Rho-associated kinase pathway.

Rabbit polyclonal anti-ETV4 antibody reacts with bovine, mouse, human, and rat ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factors.

면역원

Synthetic peptide directed towards the middle region of human ETV4

애플리케이션

Rabbit Anti-ETV4 antibody has been used for immunofluorescence applications at 1:200 dilution using formaldehyde-fixed cells. The antibody can also be used for western blot applications at 0.5μg/ml.

Rabbit polyclonal anti-ETV4 antibody is used to tag ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor in cell mobilization and tumor metastasis/invasivness.

생화학적/생리학적 작용

The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.

서열

Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable