AG549

α-synuclein 61-140, human

• UNSPSC 코드: 12352203
• eCl@ss: 32160702
• NACRES: NA.77

속성

• 생물학적 소스: human
• Quality Level: 100
• 분석: >95% (SDS-PAGE)
• 양식: powder
• 분자량: M_w 8,460 Da
• 제조업체/상표: Chemicon^®
• 기술: cell based assay: suitable
• NCBI 수납 번호: NM_000345.2; NM_007308.1
• UniProt 수납 번호: P37840
• 배송 상태: dry ice
• 유전자 정보: human ... SNCA(6622)

설명

일반 설명

Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein. Interest in synuclein research started with the discovery of alpha-synuclein mutation in several families with autosomal dominant Parkinson′s disease (PD). Alpha-synuclein is abundantly expressed in the brain and is found in a classic amyloid fibril form within the intra-neuronal Lewy body deposits of PD. The physiological function of synucleins is not well understood, but appears to involve membrane interactions, and in particular reversible binding to synaptic vesicle membranes. Contradictory evidences regarding inhibitory action of alpha-synuclein against phospholipase D (PLD) have been reported (PMID 11821392 & 19146388). Clone Syn211, Cat. No. 36-008-C detects epitope in the region from amino acid 121 to 125 and has been used together with clone LB509, Cat. No. MABN824, to characterize the digestion pattern of different forms of in vitro prepared alpha-synclulein aggregates (Guo, J.L., et al. 2013; PMID 23827677).

MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEE-
GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
An additional amino acid (Met) is attached at the N-terminus.

Product Source: E. coli

애플리케이션

Research Category
Neuroscience

Research Sub Category
Neurodegenerative Diseases

물리적 형태

White lyophilized powder. Resuspend in sterile water at concentration of 1 mg/mL. This will give you a final of 20 mM Tris/HCI, pH 7.5, 100 mM NaCl.

저장 및 안정성

Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.

법적 정보

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1