WH0117581M1

Monoclonal Anti-TWIST2 antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-DERMO1, Anti-MGC117334, Anti-twist homolog 2 (Drosophila)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3C8, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: BC033168
• N° accesso UniProt: Q8WVJ9
• applicazioni: research pathology
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TWIST2(117581)

Descrizione

Descrizione generale

Twist family bHLH transcription factor 2 (TWIST2) is part of the basic helix-loop-helix protein (bHLH) family. It acts as a molecular switch by activating or repressing target genes. The TWIST2 gene is localized on human chromosome 2q37.3.

Immunogeno

TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH

Applicazioni

Monoclonal Anti-TWIST2 antibody produced in mouse has been used in immunohistochemistry.

Azioni biochim/fisiol

Twist family bHLH transcription factor 2 (TWIST2) modulates transcription in mesenchymal cell lineages during development. It interacts with E-protein modulators and binds with E-box on DNA sequences. Mutations in the TWIST2 gene have been linked with Setleis syndrome.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)