WH0006817M1

Monoclonal Anti-SULT1A1 antibody produced in mouse

clone 1F8, ascites fluid

• Sinonimo/i: Anti-HAST1/HAST2, Anti-MGC5163, Anti-PPST, Anti-PST, Anti-ST1A3, Anti-STP, Anti-STP1, Anti-TSPST1, Anti-sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 1F8, monoclonal
• Reattività contro le specie: human
• tecniche: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgMκ
• N° accesso Genebanck: BC000923
• N° accesso UniProt: P50225
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SULT1A1(6817)

Descrizione

Descrizione generale

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. (provided by RefSeq)

Immunogeno

SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Stato fisico

Solution

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)