WH0004609M2

Anti-c-Myc Tag Antibody

mouse monoclonal, 1G7

• Sinonimo/i: Anti-cMyc, Anti-v-Myc myelocytomatosis viral oncogene homolog (avian)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Nome del prodotto: Monoclonal Anti-MYC antibody produced in mouse, clone 1G7, purified immunoglobulin, buffered aqueous solution
• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1G7, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG3κ
• N° accesso Genebanck: NM_002467
• N° accesso UniProt: P01106
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MYC(4609)

Descrizione

Descrizione generale

MYC (MYC proto-oncogene) is a transcriptional factor and oncoprotein. c-myc is a member of MYC gene family. It is located on human chromosome 8q24. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor.

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-terminal. The synthesis of non-AUG initiated protein is suppressed in Burkitt′s lymphomas, suggesting its importance in the normal function of this gene. (provided by RefSeq)

Immunogeno

MYC (NP_002458, 330 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Azioni biochim/fisiol

The cellular myelocytomatosis (c-myc) oncogene plays a major role in cellular proliferation, differentiation and apoptosis. It acts as transcriptional regulator of gene expression. MYC (MYC proto-oncogene) may be essential for cancer initiation, promotion and therapy resistance. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)