Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAE0103

Sigma-Aldrich

A2A (Adenosine Receptor A2A)

recombinant, expressed in Sf9 cells

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352202
NACRES:
NA.26

Ricombinante

expressed in Sf9 cells

Descrizione

N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.

Saggio

≥90% (SDS-PAGE)

Stato

aqueous solution

PM

47.7 kDa

Concentrazione

1.72 mg/mL

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−70°C

Azioni biochim/fisiol

A2A is a class A GPCR involved in regulating myocardial blood flow and hypertension.

Sequenza

MWSHPQFEKHHHHHHHHENLYFQGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Nota sulla preparazione

50mM Hepes pH 7.4, 200mM NaCl, 0.05%/0.006% DDM/CHS

Stoccaggio e stabilità

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -70°C.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documenti section.

Se ti serve aiuto, non esitare a contattarci Servizio Clienti

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Robert D Leone et al.
Computational and structural biotechnology journal, 13, 265-272 (2015-05-06)
The last several years have witnessed exciting progress in the development of immunotherapy for the treatment of cancer. This has been due in great part to the development of so-called checkpoint blockade. That is, antibodies that block inhibitory receptors such
Byron Carpenter et al.
Frontiers in pharmacology, 8, 898-898 (2018-01-10)
Adenosine receptors (ARs) comprise the P1 class of purinergic receptors and belong to the largest family of integral membrane proteins in the human genome, the G protein-coupled receptors (GPCRs). ARs are classified into four subtypes, A1, A2A, A2B, and A3

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.