SAB2109067

Anti-FABP1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: FABPL, L-FABP
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 14 kDa
• Reattività contro le specie (prevista in base all’omologia): goat, human, rabbit, horse, bovine, guinea pig, canine, mouse, zebrafish
• Concentrazione: 0.5 mg/mL
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL
• N° accesso NCBI: NM_001443
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FABP1(57396)

Descrizione

Descrizione generale

FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid bi

Immunogeno

Synthetic peptide directed towards the N terminal region of human FABP1

Sequenza

Synthetic peptide located within the following region: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable