SAB2104723

Anti-SLC26A4 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-DFNB4, Anti-PDS
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 86 kDa
• Reattività contro le specie: mouse, human, dog, guinea pig, rabbit
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NM_000441
• N° accesso UniProt: O43511
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SLC26A4(5172)

Descrizione

Descrizione generale

The solute carrier family 26 member 4 (SLC26A4) gene encodes for the protein, pendrin. This protein is localized in the thyroid and inner ear. The SLC26A4 gene is located on the human chromosome at 7q22.3.

Immunogeno

Synthetic peptide directed towards the middle region of human SLC26A4

Applicazioni

Anti-SLC26A4 antibody produced in rabbit has been used in immunofluorescent staining.

Azioni biochim/fisiol

Pendrin is a transmembrane protein and is involved in the exchange of anions. Mutations in the SLC26A4 gene are associated with Pendred syndrome which is an autosomal recessive disorder, identified by goiter and sensorineural hearing loss. SLC26A4 gene mutations lead to an enlarged vestibular aqueduct (EVA), which is an inner ear malformation with non-syndromic deafness.

Sequenza

Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable