SAB2102232

Anti-SMAD4 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-DPC4, Anti-JIP, Anti-MADH4, Anti-SMAD family member 4
• Numero MDL: MFCD01634190
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Forma dell’anticorpo: affinity isolated antibody
• Livello qualitativo: 100
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 60 kDa
• Reattività contro le specie: horse, bovine, sheep, guinea pig, dog, mouse, human, rat, rabbit, goat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso UniProt: Q13485
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SMAD4(4089)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human SMAD4

Azioni biochim/fisiol

SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantl

Sequenza

Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable