Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB1407409

Sigma-Aldrich

Anti-CD209 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1, MGC129965

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

antigen ~45.8 kDa

Reattività contro le specie

human

tecniche

western blot: 1 μg/mL

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CD209(30835)

Descrizione generale

Cluster of differentiation 209 (CD209), also known as dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN), is part of the innate immune system. It is expressed by intestinal dendritic cells and alveolar macrophages. The gene encoding this C-type lectin contains seven exons and is localized on human chromosome 19p13.2.
This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Immunogeno

CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein.

Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Azioni biochim/fisiol

Cluster of differentiation 209 (CD209) mediates viral infection and activates immune responses. It activates T-cells and aids in their growth. The protein recognizes various pathogens and triggers immunosuppressive reactions. It is involved in the innate immune system. It recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses that have severe health impacts on humans. CD209/ DC-SIGN mediates the entry of various viruses such as dengue virus, human immunodeficiency virus (HIV), Ebola virus and human cytomegalovirus into the human cells. CD209 acts as an alternative receptor for SARS-CoV-2, a causative agent for the novel coronavirus disease 2019 (COVID-19).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Genetic variants of CD209 associated with Kawasaki disease susceptibility.
Kuo HC, et al.
PLoS ONE, 9(8), e105236-e105236 (2014)
CD209 promoter polymorphisms associate with HCV infection and pegylated-interferon plus ribavirin treatment response.
Zupin L, et al.
Molecular Immunology, 76, 49-54 (2016)
Human DC-SIGN binds specific human milk glycans.
Noll AJ, et al.
The Biochemical Journal (2016)
The activation of B cells enhances DC-SIGN expression and promotes susceptibility of B cells to HPAI H5N1 infection.
Na-Ek P, et al.
Biochemical and Biophysical Research Communications, 490(4), 1301-1306 (2017)
The association between CD209 gene polymorphisms and pulmonary tuberculosis susceptibility: a meta-analysis.
Yi L, et al.
International Journal of Clinical and Experimental Pathology, 8(10), 12437-12437 (2015)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.