SAB1404142

Monoclonal Anti-NPAS2 antibody produced in mouse

clone 6C9, ascites fluid

• Sinonimo/i: FLJ23138, MGC71151, MOP4, PASD4, bHLHe9
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Clone: 6C9, monoclonal
• application: ELISA (i); WB
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 6C9, monoclonal
• PM: antigen ~36.34 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_002518
• N° accesso UniProt: Q99743
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NPAS2(4862)

Descrizione

Descrizione generale

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain. (provided by RefSeq)

Immunogeno

NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH

Stato fisico

Clear solution

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable