Passa al contenuto
Merck
Tutte le immagini(8)

Documenti fondamentali

HPA004114

Sigma-Aldrich

Anti-MRC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-C-type lectin domain family 13 member D, Anti-CD206 antigen, Anti-MMR, Anti-Macrophage mannose receptor 1 precursor

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

Sequenza immunogenica

NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MRC1(4360)

Descrizione generale

Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein, that is expressed at high levels in the M2 macrophages. This functional gene has 30 exons and is of 101.74 kb. MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), 8 C-type lectin-like domains (CTLDs), a single transmembrane domain (TM) and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.

Immunogeno

Macrophage mannose receptor 1 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-MRC1 antibody has been used:
  • in immunofluorescence Ab staining
  • in confocal microscopy
  • in immunohistochemical staining

Azioni biochim/fisiol

Mannose receptor, C type 1 (MRC1) encodes for human mannose receptor (MR) and is a member of the C-type lectin receptors family. It recognizes and binds to Mycobacterium tuberculosis by the extracellular structure. It plays a role in antigen-presenting and maintaining a stable internal environment. It plays a critical role in controlling immune response and in regulating allergen induced allergic responses in asthma. This gene along with HSP70 family members through the receptor cytoplasmic tail may contribute to MR trafficking in macrophages.
Mannose receptor, C type 1 (MRC1) is involved in phagocytosis.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86249

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: implications for understanding lung disease in humans
Cai Y, et al.
Journal of Immunology, 17(1), 1302269-1302269 (2014)
Alfonso Eirin et al.
Journal of hypertension, 32(1), 154-165 (2013-09-21)
Renovascular hypertension (RVHT) increases cardiovascular morbidity and mortality. Renal revascularization with percutaneous transluminal renal angioplasty and stenting (PTRS) may reverse RVHT but may not fully regress cardiac remodeling and damage, possibly due to persistent myocardial insults. Bendavia is a mitochondrial
Xing Zhang et al.
Molecular biology reports, 40(8), 5073-5083 (2013-05-09)
The MRC1 gene, encoding the human mannose receptor (MR), is a member of the C-type lectin receptors family. MR can recognize and bind to Mycobacterium tuberculosis by the extracellular structure, and play a role in antigen-presenting and maintaining a stable
Li Liu et al.
JCI insight, 4(4) (2019-03-05)
Newly emerging viruses, such as severe acute respiratory syndrome coronavirus (SARS-CoV), Middle Eastern respiratory syndrome CoVs (MERS-CoV), and H7N9, cause fatal acute lung injury (ALI) by driving hypercytokinemia and aggressive inflammation through mechanisms that remain elusive. In SARS-CoV/macaque models, we
M Mark et al.
ESMO open, 7(3), 100446-100446 (2022-04-16)
The SAKK 17/16 study showed promising efficacy data with lurbinectedin as second- or third-line palliative therapy in malignant pleural mesothelioma. Here, we evaluated long-term outcome and analyzed the impact of lurbinectedin monotherapy on the tumor microenvironment at the cellular and

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.