AV53631
Anti-NUP98 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-ADIR2, Anti-NUP196, Anti-Nucleoporin 98 kDa
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
98 kDa
Reattività contro le specie
horse, human, rabbit, bovine, rat
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... NUP98(4928)
Descrizione generale
Nuclear pore complex protein is a protein encoded by the nucleoporin 98 kDa (NUP98) gene in humans. NUP98 gene encodes a peripheral membrane protein nucleoporin that belongs to nucleoporin GLFG family. This protein is formed from a precursor protein of 186 kDa that after cleavage yields two nucleoporins, Nup96 and Nup98. The nuclear import and export takes place through the nuclear pore complex (NPC), which is composed of unique proteins known as nucleoporins. The NUP98 gene of 122kb long, has 33 exons and is located on human chromosome 11p15.4.
Immunogeno
Synthetic peptide directed towards the N terminal region of human NUP98
Applicazioni
Anti-NUP98 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Azioni biochim/fisiol
Nucleoporin 98 kDa (NUP98) functions as a docking protein for cytosol mediated docking of import substrates. During mitosis, NUP98 interacts with nucleocytoplasmic transport factors Rae1 and regulates the destruction of the securin protein by the anaphase-promoting complex (APC). Thus, Nucleoporins play an important function in nucleocytoplasmic transport, transcription and mitosis. Nuclear pore complex (NPC) also plays a role during nuclear processes such as chromatin silencing, transcriptional regulation and DNA damage repair. NUP98-Rae1 complex prevents aneuploidy. Overexpression of NUP98 along with other proteins and several associated nuclear export factors dysregulate signaling pathways and transcription resulting in alteration of nucleoporin functionality, which may cause cancer. NUP98 acts as an important predictor of anthracycline-based chemotherapy response in triple-negative breast cancer patients.
Sequenza
Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Dan N Simon et al.
Advances in experimental medicine and biology, 773, 285-307 (2014-02-25)
The nuclear pore complex (NPC) mediates trafficking between the cytoplasm and nucleoplasm. It also plays key roles in other nuclear processes such as chromatin silencing, transcriptional regulation, and DNA damage repair. Nucleoporins, the structural components of the NPC, have been
Paul B Mullan et al.
BMC cancer, 19(1), 236-236 (2019-04-03)
Triple Negative breast cancer (TNBC) is a poor outcome subgroup of breast cancer defined based on the absence of expression of ERα and PR and HER2 amplification. These hard to treat cancers lack targeted treatment options and are therefore treated
S P Romana et al.
Leukemia, 20(4), 696-706 (2006-02-10)
The NUP98 gene is fused with 19 different partner genes in various human hematopoietic malignancies. In order to gain additional clinico-hematological data and to identify new partners of NUP98, the Groupe Francophone de Cytogénétique Hématologique (GFCH) collected cases of hematological
Akiko Takeda et al.
Seminars in cancer biology, 27, 3-10 (2014-03-25)
Hematologic malignancies are often associated with chromosomal rearrangements that lead to the expression of chimeric fusion proteins. Rearrangements of the genes encoding two nucleoporins, NUP98 and NUP214, have been implicated in the pathogenesis of several types of hematologic malignancies, particularly
Y Arai et al.
Blood, 89(11), 3936-3944 (1997-06-01)
The inv(11)(p15q22) is a recurrent chromosomal abnormality associated with de novo and therapy-related myeloid malignancies. Here we report the molecular definition of this chromosomal aberration in four patients. Positional cloning showed the consistent rearrangement of the DDX10 gene on chromosome
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.