Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV49932

Sigma-Aldrich

Anti-PLXNA2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-FLJ11751, Anti-FLJ30634, Anti-KIAA0463, Anti-OCT, Anti-PLXN2, Anti-Plexin A2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

211 kDa

Reattività contro le specie

mouse, rat, horse, dog, guinea pig, rabbit, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PLXNA2(5362)

Descrizione generale

In the fetal samples, Plexin A2 (PLXNA2) has prominent expression in fetal neural tissue.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PLXNA2

Applicazioni

Anti-PLXNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

Plexin A2 (PLXNA2) is a coreceptor for semaphorins that are involved in immune responses, activation of immune cells and axon guidance during neuronal development. PLXNA2 acts as a receptor of Sema6A and has a role in limiting adult axon growth and recovery post trauma. PLXNA2 is up-regulated in metastatic prostate cancer tumors and breast cancer. Copy number variation in PLXNA2 is associated with Tetralogy of Fallot (TOF), a cyanotic congenital heart disease. Dysregulation of PLXNA2-semaphorin signaling results in congenital heart disease, characteristic of cardiac outflow tract (OFT) defect. PLXNA2 is up-regulated by osteogenic factor BMP2. Up-regulated PLXNA2 mediates osteoblast differentiation by regulation of RUNX2 (Runt-related transcription factor 2) expression.

Sequenza

Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

T V Tian et al.
Oncogene, 33(17), 2204-2214 (2013-05-28)
Prostate cancer (PCa) is one of the major public health problems in Western countries. Recently, the TMPRSS2:ERG gene fusion, which results in the aberrant expression of the transcription factor ERG, has been shown to be the most common gene rearrangement
Ji-Eun Oh et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 27(3), 552-562 (2011-11-19)
The imbalance between bone-resorbing osteoclasts and bone-forming osteoblasts often leads to bone destructive diseases such as osteoporosis. In contrast to the development of several antiresorptive agents for osteoporosis therapy, discovery of anabolic drugs has been difficult because of an insufficient
Sang-Ohk Shim et al.
Molecular and cellular neurosciences, 50(2), 193-200 (2012-05-09)
Axonal growth from both intact and severed fibers is limited after adult mammalian CNS injury. Myelin proteins contribute to inhibition of axonal growth. Semaphorin6A protein inhibits the extension of developing axons and is highly expressed in adult oligodendrocytes. This expression
Candice K Silversides et al.
PLoS genetics, 8(8), e1002843-e1002843 (2012-08-23)
Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about
P N Gabrovska et al.
Gene, 489(2), 63-69 (2011-09-20)
Gene expression profiling has enabled us to demonstrate the heterogeneity of breast cancers. The potential of a tumour to grow and metastasise is partly dependant on its ability to initiate angiogenesis or growth and remodelling of new blood vessels, usually

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.