AV50251
Anti-COX3 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-Cytochrome c oxidase III
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
29 kDa
Reattività contro le specie
human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... MTCO3(4514)
Descrizione generale
Mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) is encoded by the mitochondrial DNA and localizes to the inner mitochondrial membrane. COX3 is generally mentioned as COXIII.
Immunogeno
Synthetic peptide directed towards the C terminal region of human COX3
Applicazioni
Anti-COX3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Azioni biochim/fisiol
Cytochrome oxidases make up the terminal complex of the electron transport chain in the mitochondria. Deletions in mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) gene are associated with rhabdomyolysis. Mutation in COX3 is linked to maternally inherited diabetes and deafness associated with nephropathy. COX3 mutations have been observed in asthenozoospermic infertile men, patients with MELAS (mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes) and Leber hereditary optic neuropathy. Hepatitis B virus X protein interacts with COX3 and the intercation might be crucial for hepatocarcinoma tumorigenesis.
Sequenza
Synthetic peptide located within the following region: FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Siwar Baklouti-Gargouri et al.
Journal of assisted reproduction and genetics, 31(5), 595-600 (2014-02-20)
Infertility affects 10-15 % of the population, of which, approximately 40 % is due to male etiology consisting primarily of low sperm count (oligozoospermia) and/or abnormal sperm motility (asthenozoospermia). It has been demonstrated that mtDNA base substitutions can greatly influence
Structure and function of cytochrome c oxidase.
R A Capaldi
Annual review of biochemistry, 59, 569-596 (1990-01-01)
Structure and assembly of cytochrome c oxidase.
R A Capaldi
Archives of biochemistry and biophysics, 280(2), 252-262 (1990-08-01)
Dan Li et al.
International journal of molecular medicine, 35(2), 319-324 (2014-12-09)
The hepatitis B virus (HBV) X protein (HBx) plays an important pathogenetic role in hepatocarcinoma tumorigenesis. As HBx does not have the ability to bind to double-stranded DNA (dsDNA), protein-protein interaction is crucial for HBx functions. In a previous study
Mouna Tabebi et al.
Biochemical and biophysical research communications, 459(3), 353-360 (2015-02-24)
Mitochondrial diabetes (MD) is a heterogeneous disorder characterized by a chronic hyperglycemia, maternal transmission and its association with a bilateral hearing impairment. Several studies reported mutations in mitochondrial genes as potentially pathogenic for diabetes, since mitochondrial oxidative phosphorylation plays an
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.