AV46789

Anti-LMAN2 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-C5orf8, Anti-GP36B, Anti-Lectin, mannose-binding 2, Anti-VIP36
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 40 kDa
• Reattività contro le specie: mouse, dog, rat, human, bovine, horse, rabbit, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_006807
• N° accesso UniProt: Q12907
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... LMAN2(10960)

Descrizione

Immunogeno

Synthetic peptide directed towards the C terminal region of human LMAN2

Applicazioni

Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Azioni biochim/fisiol

LMAN2 (Lectin, mannose-binding 2) gene encodes a type I transmembrane lectin protein localized in endoplasmic reticulum, the Golgi apparatus and the plasma membrane. It plays a pivotal role in sorting, trafficking and quality control of secretory proteins and/or lipids.

Sequenza

Synthetic peptide located within the following region: LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable