Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

AV41516

Sigma-Aldrich

Anti-SLC22A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-1-Oct, Anti-HOCT1, Anti-Oct1_cds, Anti-Solute carrier family 22 (organic cation transporter), member 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

bovine, rat, human, horse, guinea pig, rabbit, dog, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC22A1(6580)

Descrizione generale

Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various external origin cationic toxins and drugs. Examples of drugs transported by OCT1 include metformin, amantadine, pramipexole, and, possibly, levodopa.

Specificità

Anti-SLC22A1 (AB1) polyclonal antibody reacts with chicken, pig, bovine, rabbit, human, mouse, rat, and canine solute carrier family 22 (organic cation transporter), member 1 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human SLC22A1

Applicazioni

Anti-SLC22A1 (AB1) polyclonal antibody is used to tag solute carrier family 22 (organic cation transporter), member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 22 (organic cation transporter), member 1 in the transport of small organic cations including a variety of important drugs.

Azioni biochim/fisiol

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.

Sequenza

Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Tianxiang Kevin Han et al.
Molecular pharmacology, 84(2), 182-189 (2013-05-18)
Organic cation transporters (OCTs) are members of the solute carrier 22 family of transporter proteins that are involved in absorption, distribution, and excretion of organic cations. OCT3 is localized in the apical (AP) membrane of enterocytes, but the literature is
Eric D Segal et al.
Biochemical and biophysical research communications, 414(4), 694-699 (2011-10-12)
Epidemiologic and laboratory data suggesting that metformin has antineoplastic activity have led to ongoing clinical trials. However, pharmacokinetic issues that may influence metformin activity have not been studied in detail. The organic cation transporter 1 (OCT1) is known to play
Ruijin Shao et al.
Journal of experimental & clinical cancer research : CR, 33, 41-41 (2014-06-03)
Although a number of in vitro studies have demonstrated the antiproliferative, anti-invasive, and antimetastatic effects of metformin in multiple cancer cell types, its cellular and molecular mechanisms of anti-cancer action in the endometrium of women with polycystic ovary syndrome (PCOS)
Xin Li et al.
American journal of translational research, 7(3), 574-586 (2015-06-06)
Conflicting results have been reported regarding whether or not insulin-regulated glucose transporter 4 (GLUT4) is expressed in human and rodent endometria. There is an inverse relationship between androgen levels and insulin-dependent glucose metabolism in women. Hyperandrogenemia, hyperinsulinemia, and insulin resistance

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.