Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

AV39489

Sigma-Aldrich

Anti-GRHL3 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Grainyhead-like 3 (Drosophila)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

57 kDa

Reattività contro le specie

rabbit, dog, horse, bovine, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

ChIP: suitable
immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_067003

N° accesso UniProt

Q8TE85-4

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GRHL3(57822)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the C terminal region of human GRHL3

Azioni biochim/fisiol

GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.

Sequenza

Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Zhengquan Yu et al.
The EMBO journal, 28(13), 1890-1903 (2009-06-06)
Skin and bladder epithelia form effective permeability barriers through the activation of distinct differentiation gene programs. Using a genome-wide gene-expression study, we identified transcriptional regulators whose expression correlates highly with that of differentiation markers in both the bladder and skin
Charbel Darido et al.
Cancer cell, 20(5), 635-648 (2011-11-19)
Despite its prevalence, the molecular basis of squamous cell carcinoma (SCC) remains poorly understood. Here, we identify the developmental transcription factor Grhl3 as a potent tumor suppressor of SCC in mice, and demonstrate that targeting of Grhl3 by a miR-21-dependent
Nikki R Hislop et al.
Developmental biology, 321(1), 263-272 (2008-07-16)
In addition to its role in formation of the epidermal barrier, the mammalian transcription factor Grainy head-like 3 (Grhl3) is also essential for neural tube closure and wound repair, processes that are dependent in part on epidermal migration. Here, we

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.