Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV38386

Sigma-Aldrich

Anti-NR5A2 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

human, sheep, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NR5A2(2494)

Descrizione generale

Nuclear receptor subfamily 5, group A, member 2 (NR5A2, BIF2, FTZ-F1β) is a transcription factor involved in cholesterol transport, bile acid homeostasis and steroidogenesis. Also known as liver receptor homolog-1, LRH-1 is expressed primarily in liver, intestine, exocrine pancreas, ovary and embryonic stem cells (ESC). LRH-1 regulates the expression of the key bile acid biosynthetic enzyme cholesterol 7α hydroxylase (Cyp7A1).

Specificità

Anti-NR5A2 polyclonal antibody reacts with human and bovine nuclear receptor subfamily 5, group A, member 2/ liver receptor homolog-1 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human NR5A2

Applicazioni

Anti-NR5A2 polyclonal antibody is used to tag liver receptor homolog-1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of liver receptor homolog-1 in the regulation of bile acid biosynthesis, cholesterol transport and steroidogenesis.

Azioni biochim/fisiol

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Sequenza

Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.