Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV37145

Sigma-Aldrich

Anti-SREBF1 (AB1) antibody produced in rabbit

affinity isolated antibody

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

125 kDa

Reattività contro le specie

mouse, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

mouse ... SREBF1(20787)

Descrizione generale

Sterol regulatory element-binding protein 1 (SREBP1) is a member of the basic helix-loop-helix (bHLH) family of transcription factors.

Immunogeno

Synthetic peptide directed towards the N terminal region of mouse SREBF1

Azioni biochim/fisiol

Sterol regulatory element-binding protein 1 (SREBP1) regulates de novo lipogenesis. It can be used as a biomarker and a therapeutic target due to its function as an oncogene and a pro-proliferation factor in thyroid cancer. It bind to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.
Sterol regulatory element-binding transcription factor 1 (SREBF1) binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.

Sequenza

Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Delphine Eberlé et al.
Biochimie, 86(11), 839-848 (2004-12-14)
Sterol regulatory element binding proteins (SREBPs) are a family of transcription factors that regulate lipid homeostasis by controlling the expression of a range of enzymes required for endogenous cholesterol, fatty acid (FA), triacylglycerol and phospholipid synthesis. The three SREBP isoforms
Liwei Zhang et al.
Cardiovascular drugs and therapy, 28(4), 303-311 (2014-06-14)
Inflammation participates centrally in all stages of atherosclerosis (AS), which begins with pro-inflammatory processes and inflammatory changes in the endothelium, related to lipid metabolism. MicroRNA (miRNA) inhibition of inflammation related to SIRT1 has been shown to be a promising therapeutic

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.