Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV13110

Sigma-Aldrich

Anti-TRH antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-MGC125964, Anti-MGC125965, Anti-Thyrotropin-releasing hormone

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

26 kDa

Reattività contro le specie

bovine, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TRH(7200)

Descrizione generale

Rabbit polyclonal anti-TRH antibody reacts with zebrafish, human, canine, chicken, and bovine thyrotrophin-releasing hormones.
Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. TRH is a highly specific regulator of the thyrotropin-stimulating hormone (TSHβ) gene expression in the pituitary via a nerve growth factor IB (NGFIB, NR4A1, Nur77)/PKC/ERK1/2 pathway.

Immunogeno

Synthetic peptide directed towards the C terminal region of human TRH

Applicazioni

Rabbit polyclonal anti-TRH antibody is used to tag thyrotrophin-releasing hormone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of thyrotrophin-releasing hormone in the regulation of the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. Anti-TRH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Sequenza

Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.