Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

AV100816

Sigma-Aldrich

Anti-NR2F2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-ARP1, Anti-COUP-TFII, Anti-COUPTFB, Anti-MGC117452, Anti-Nuclear receptor subfamily 2, group F, member 2, Anti-SVP40, Anti-TFCOUP2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

45 kDa

Reattività contro le specie

dog, pig, human, mouse, rabbit, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NR2F2(7026)

Immunogeno

Synthetic peptide directed towards the N terminal region of human NR2F2

Applicazioni

Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Azioni biochim/fisiol

NR2F2 is an orphan nuclear receptor that plays an important role in metabolism and development. The crosstalk between NR2F2 and the transcription factor HNF4α is involved in regulation of insulin secretion and maintenance of glucose homeostasis. NR2F2 collaborates with OCT4 and miR-302 in differentiation of human embryonic stem cells and specification of neural ectoderm during development.

Sequenza

Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Alessandro Rosa et al.
The EMBO journal, 30(2), 237-248 (2010-12-15)
Multiple levels of control are in play to regulate pluripotency and differentiation in human embryonic stem cells (hESCs). At the transcriptional level, the core factors OCT4, NANOG and SOX2 form a positive autoregulatory loop that is pivotal for maintaining the
Marie Boutant et al.
PloS one, 7(5), e35810-e35810 (2012-05-19)
The Nuclear Receptor 2F2 (NR2F2/COUP-TFII) heterozygous knockout mice display low basal insulinemia and enhanced insulin sensitivity. We previously established that insulin represses NR2F2 gene expression in pancreatic β-cells. The cis-regulatory region of the NR2F2 promoter is unknown and its influence

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.