Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV32533

Sigma-Aldrich

Anti-SPDEF (AB1) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Spdef Antibody, Spdef Antibody - Anti-SPDEF (AB1) antibody produced in rabbit, Anti-PDEF, Anti-RP11-375E1__A.3, Anti-SAM pointed domain containing ets transcription factor, Anti-bA375E1.3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

bovine, rabbit, human, dog, guinea pig

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SPDEF(25803)

Descrizione generale

Rabbit polyclonal anti-SPDEF (AB1) antibody reacts with human, mouse, rat, bovine, pig, and canine SAM pointed domain containing ets transcription factors.
SAM pointed domain containing ets transcription factor (SPDEF, PDEF) is involved in the regulation of terminal differentiation of goblet/Paneth progenitor cells into intestinal Paneth and goblet cells. SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
SPDEF suppresses the metastasis of prostate cancer and modulates goblet cell hyperplasia in airway epithelial cells.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.

Immunogeno

Synthetic peptide directed towards the middle region of human SPDEF

Applicazioni

Rabbit Anti-SPDEF (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.
Rabbit polyclonal anti-SPDEF (AB1) antibody is used to tag SAM pointed domain containing ets transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of SAM pointed domain containing ets transcription factor in the differentiation of Paneth and goblet cells and mucin production.

Azioni biochim/fisiol

PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Giuseppe Lo Sasso et al.
PloS one, 9(7), e102495-e102495 (2014-07-12)
Dysfunction of Paneth and goblet cells in the intestine contributes to inflammatory bowel disease (IBD) and colitis-associated colorectal cancer (CAC). Here, we report a role for the NAD+-dependent histone deacetylase SIRT1 in the control of anti-bacterial defense. Mice with an
Joshua J Steffan et al.
The Journal of biological chemistry, 287(35), 29968-29978 (2012-07-05)
Emerging evidence suggests that the SAM pointed domain containing ETS transcription factor (SPDEF) plays a significant role in tumorigenesis in prostate, breast, colon, and ovarian cancer. However, there are no in vivo studies with respect to the role of SPDEF
Kwon-Sik Park et al.
The Journal of clinical investigation, 117(4), 978-988 (2007-03-10)
Goblet cell hyperplasia and mucous hypersecretion contribute to the pathogenesis of chronic pulmonary diseases including cystic fibrosis, asthma, and chronic obstructive pulmonary disease. In the present work, mouse SAM pointed domain-containing ETS transcription factor (SPDEF) mRNA and protein were detected
Xin-Hua Cheng et al.
PLoS genetics, 10(9), e1004656-e1004656 (2014-09-26)
SAM-pointed domain-containing ETS transcription factor (SPDEF) is expressed in normal prostate epithelium. While its expression changes during prostate carcinogenesis (PCa), the role of SPDEF in prostate cancer remains controversial due to the lack of genetic mouse models. In present study

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.