Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

SAB2108752

Sigma-Aldrich

Anti-WT1

affinity isolated antibody

Sinónimos:

Anti- AWT1, Anti- WAGR, Anti- WIT-2, Anti- WT33, Anti-GUD

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

56 kDa

reactividad de especies

human, rabbit, dog, rat, mouse

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable
immunohistochemistry: suitable

nº de acceso

NM_024424

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... WT1(7490)

Descripción general

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Inmunógeno

Synthetic peptide directed towards the middle region of human WT1

Acciones bioquímicas o fisiológicas

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Secuencia

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The role of Wt1 in regulating mesenchyme in cancer, development, and tissue homeostasis
Chau YY and Hastie ND
Trends in Genetics, 28(10), 515-524 (2012)
New insights into DNA-binding behaviour of Wilms Tumor Protein (WT1)?A dual study
Nurmemmedov E, et al.
Biophysical Chemistry, 145(2-3), 116-125 (2009)
The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity
Rivera et al.
Proceedings of the National Academy of Sciences of the USA, 106(20), 8338-8343 (2009)
Donor splice-site mutations in WT1 are responsible for Frasier syndrome
Barbaux S, et al.
Nature Genetics, 17(4), 467-467 (1997)
Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll R, et al.
Journal of Molecular Biology, 372(5), 1227-1245 (2007)

Global Trade Item Number

Número de referencia del producto (SKU)GTIN
SAB2108752-100UL4061836137243

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico