SAB1412291

ANTI-MAPKAPK2 antibody produced in mouse

clone 1F9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MAPKAPK2, MK2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1F9, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 35.2 kDa
• reactividad de especies: human
• técnicas: immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_032960
• Nº de acceso UniProt: P49137
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MAPKAPK2(9261)

Descripción

Descripción general

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Inmunógeno

MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable