MSST0001
SILu™Prot APOA1, Apolipoprotein A-1 human
recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled
Sinónimos:
SILu™Prot Apolipoprotein A-1
About This Item
Productos recomendados
origen biológico
human
Nivel de calidad
recombinante
expressed in HEK 293 cells
etiqueta
His tagged
V5 tagged
Ensayo
≥98% (SDS-PAGE)
Formulario
lyophilized powder
envase
vial of ≥10 μg (Lot-specific vial content given on certificate of analysis)
técnicas
mass spectrometry (MS): suitable
Nº de acceso UniProt
temp. de almacenamiento
−20°C
Información sobre el gen
human ... APOA1(335)
Categorías relacionadas
Descripción general
Aplicación
Characterization of Heavy Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows
Characterization of stable isotope labeled APO-A1 for use as an internal standard in a quantitative MS workflow
Characterization of Clinically-Relevant Stable Isotope Labeled Recombinant Proteins for Use as Internal Standards in Quantitative MS Workflows
Forma física
Nota de preparación
Almacenamiento y estabilidad
Nota de análisis
SILu™Prot ApoA−Ι is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A-Ι is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.
Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ
The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).
Label Incorporation
≥ 98% as determined by mass spectrometry
Other Characterization
- Sequence confirmed by intact mass analysis
- Identity verified by peptide mapping
- Purity >98% by SDS-PAGE
- Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Información legal
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico