Saltar al contenido
Merck

HPA001815

Sigma-Aldrich

Anti-VWF antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-vWF antibody produced in rabbit, Anti-von Willebrand factor precursor antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... VWF(7450)

¿Está buscando productos similares? Visita Guía de comparación de productos

Inmunógeno

von Willebrand factor precursor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-VWF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

Von Willebrand factor (VWF) is a large, adhesive glycoprotein synthesized only by endothelial cells and megakaryocytes, a platelet precursor. It is stored in α-granules in megakaryocytes or Weibel-Palade bodies in endothelial cells. In immature state, it is called as pre-pro-VWF molecule. It consists of D1 and D2 domains which are essential for multimerization. Upon maturation, it develops two other domains. During maturation the signal peptide of pro-VWF is cleaved to form C-terminal dimers in endoplasmic reticulum. The dimers are subjected to further modifications such as carbohydrate processing, sulfation and amino-terminal multimerization. The mature VWF plays major role in hemostasis. Firstly, it helps in attaching platelets through the glycoprotein Ib receptor to subendothelial tissue at the site of vascular injury. It also act as carrier protein for protecting coagulation factor VIII from proteolytic degradation by plasma enzymes. Deficiency or any alteration in VWF results in von Willebrand disease, a common hereditary bleeding disorder.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST83058

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Dinender K Singla et al.
Journal of molecular and cellular cardiology, 40(1), 195-200 (2005-11-18)
Initial studies have suggested that transplantation of embryonic stem (ES) cells following myocardial infarction (MI) in animal models is beneficial; however, the mechanism of benefit is largely unknown. The present study investigated the fate of mouse ES cells transplanted post-MI
Feng Hao et al.
American journal of physiology. Cell physiology, 311(6), C975-C984 (2016-10-21)
Vascular smooth muscle cell (SMC) migration is an essential step involved in neointimal formation in restenosis and atherosclerosis. Lysophosphatidic acid (LPA) is a bioactive component of oxidized low-density lipoprotein and is produced by activated platelets, implying that LPA influences vascular
Yang Xu et al.
Arteriosclerosis, thrombosis, and vascular biology, 24(3), 477-482 (2004-01-24)
Arterial injury results in vascular remodeling associated with proliferation and migration of smooth muscle cells (SMCs) and the development of intimal hyperplasia, which is a critical component of restenosis after angioplasty of human coronary arteries and an important feature of
Cell biology of von Willebrand factor.
D D Wagner
Annual review of cell biology, 6, 217-246 (1990-01-01)
P C Lee et al.
The American journal of physiology, 277(4 Pt 2), H1600-H1608 (1999-10-12)
A role for nitric oxide (NO) in wound healing has been proposed; however, the absolute requirement of NO for wound healing in vivo and the contribution of endothelial NO synthase (eNOS) have not been determined. Experiments were carried out using

Artículos

Cell based angiogenesis assays to analyze new blood vessel formation for applications of cancer research, tissue regeneration and vascular biology.

Global Trade Item Number

Número de referencia del producto (SKU)GTIN
HPA001815-100UL4061837133213
HPA001815-25UL4061842779994

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico