Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV53693

Sigma-Aldrich

Anti-HSPA4L antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-APG-1, Anti-Heat shock 70 kDa protein 4-like, Anti-Osp94

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

95 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_055093

Nº de acceso UniProt

O95757

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HSPA4L(22824)

Descripción general

Heat shock 70kDa protein 4L is a protein encoded by the HSPA4L gene in humans. Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human HSPA4L

Aplicación

Anti-HSPA4L antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/mL.

Acciones bioquímicas o fisiológicas

Hspa4l is expressed ubiquitously and predominantly in the testis and is highly expressed in spermatogenic cells. It plays an important role in osmotolerance. HSPA4L and HSPA4 collaborate in embryonic lung maturation and helps in air breathing during child birth. Osp94 also acts as molecular chaperone and possesses cytoprotective role from excessive stimulation from heat, hyper-ionic and osmotic stress which cause marked perturbation of intracellular protein function including the suppression of protein synthesis.

Secuencia

Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC21953

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Belal A Mohamed et al.
American journal of respiratory cell and molecular biology, 50(4), 817-824 (2013-08-29)
Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones. We generated Hspa4l(-/-)Hspa4(-/-) mice to investigate a functional complementarity between HSPA4L and HSPA4 during embryonic development. Hspa4l(-/-)Hspa4(-/-) embryos exhibited marked pulmonary hypoplasia
H Yamamoto et al.
Neuroscience, 158(4), 1691-1698 (2008-12-09)
Osmotic stress protein 94 (OSP94), a member of the heat shock protein 110/SSE subfamily, is expressed in certain organs such as the kidney, testis, and brain where it can act as a molecular chaperon. In general, its alteration in expression
Torsten Held et al.
Molecular and cellular biology, 26(21), 8099-8108 (2006-08-23)
The Hspa4l gene, also known as Apg1 or Osp94, belongs to the HSP110 heat shock gene family, which includes three genes encoding highly conserved proteins. This study shows that Hspa4l is expressed ubiquitously and predominantly in the testis. The protein

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico