Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV50512

Sigma-Aldrich

Anti-ING1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Inhibitor of growth family, member 1, Anti-p24ING1c, Anti-p33, Anti-p33ING1, Anti-p33ING1b, Anti-p47, Anti-p47ING1a

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

32 kDa

reactividad de especies

dog, human, guinea pig, bovine, rat, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_005528

Nº de acceso UniProt

Q5T9H0

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... ING1(3621)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human ING1

Aplicación

Anti-ING1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

Inhibitor of growth family, member 1 (ING1; p47; p33) is a nuclear protein with tumor suppressor activity. It interacts with p53, participates in p53-mediated signaling and regulates cell growth and apoptosis. However, ING1 also acts independent of p53; translocates to mitochondria and induces apoptosis by altering mitochondrial membrane potential.

Secuencia

Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Julieta M Ceruti et al.
Molecular and cellular biochemistry, 378(1-2), 117-126 (2013-03-06)
ING proteins are tumor suppressors involved in the regulation of gene transcription, cell cycle arrest, apoptosis, and senescence. Here, we show that ING1b expression is upregulated by several DNA-damaging agents, in a p53-independent manner. ING1b stimulates DNA repair of a
P Bose et al.
Cell death & disease, 4, e788-e788 (2013-09-07)
The ING family of tumor suppressors acts as readers and writers of the histone epigenetic code, affecting DNA repair, chromatin remodeling, cellular senescence, cell cycle regulation and apoptosis. The best characterized member of the ING family, ING1,interacts with the proliferating

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico