Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

AV45176

Sigma-Aldrich

Anti-CDH8 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Cadherin 8, type 2, Anti-Nbla04261

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

81 kDa

reactividad de especies

human, mouse, dog, bovine, rat, horse, rabbit, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_001787

Nº de acceso UniProt

P55286

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CDH8(1006)

Inmunógeno

Synthetic peptide directed towards the middle region of human CDH8

Aplicación

Anti-CDH8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

CDH8 (Cadherin 8, type II), a classical cadherin, is a membrane protein that mediates calcium-dependent cell-cell adhesion. It is expressed predominantly in brain and modulates synaptic adhesion and axon growth. Microdeletions in CDH8 gene result in increased susceptibility to autism and learning disability.

Secuencia

Synthetic peptide located within the following region: HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

N Toni et al.
Nature, 402(6760), 421-425 (1999-12-10)
Structural remodelling of synapses and formation of new synaptic contacts has been postulated as a possible mechanism underlying the late phase of long-term potentiation (LTP), a form of plasticity which is involved in learning and memory. Here we use electron
Alistair T Pagnamenta et al.
Journal of medical genetics, 48(1), 48-54 (2010-10-26)
Autism spectrum disorder (ASD) is characterised by impairments in social communication and by a pattern of repetitive behaviours, with learning disability (LD) typically seen in up to 70% of cases. A recent study using the PPL statistical framework identified a
George W Huntley et al.
Hippocampus, 22(1), 17-28 (2010-09-18)
Cadherins are synaptic cell adhesion molecules that contribute to persistently enhanced synaptic strength characteristic of long-term potentiation (LTP). What is relatively unexplored is how synaptic activity of the kind that induces LTP-associated remodeling of synapse structure affects localization of cadherins

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico