Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV33623

Sigma-Aldrich

Anti-CLDN1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Claudin 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

23 kDa

reactividad de especies

human, dog, sheep, horse, bovine, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CLDN1(9076)

Descripción general

Claudin-1 (CLDN1) membrane protein belongs to the claudin family. It comprises four membrane-spanning regions, N- and C-terminal cytoplasmic domains, and two extracellular loops. The CLDN1 gene is mapped to human chromosome 3q28. It is expressed in the kidney, testis, intestine, brain, and liver.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CLDN1

Acciones bioquímicas o fisiológicas

Claudin-1 (CLDN1) is a key component of the tight junctions that mediate epithelial barrier functions. CLDN1 is dichotomous as it is downregulated in breast, esophageal and prostate cancer. The gene is overexpressed in oral squamous cell cancer, colon, nasopharyngeal and ovarian tumors. It is implicated in neonatal sclerosing cholangitis (NISCH) syndrome. CLDN1 is involved in dengue (DENV) entry and acts as a co-receptor for hepatitis C virus (HCV) entry.

Secuencia

Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Opcional

Referencia del producto
Descripción
Precios

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ajaz A Bhat et al.
International journal of molecular sciences, 21(2) (2020-01-19)
Claudins, a group of membrane proteins involved in the formation of tight junctions, are mainly found in endothelial or epithelial cells. These proteins have attracted much attention in recent years and have been implicated and studied in a multitude of
Pulin Che et al.
Virology, 446(1-2), 303-313 (2013-10-01)
Dengue disease is becoming a huge public health concern around the world as more than one-third of the world's population living in areas at risk of infection. In an effort to assess host factors interacting with dengue virus, we identified
Anne A Blanchard et al.
PloS one, 11(9), e0163387-e0163387 (2016-09-21)
The claudin 1 tight junction protein, solely responsible for the barrier function of epithelial cells, is frequently down regulated in invasive human breast cancer. The underlying mechanism is largely unknown, and no obvious mutations in the claudin 1 gene (CLDN1)
Smail Hadj-Rabia et al.
Gastroenterology, 127(5), 1386-1390 (2004-11-03)
Most human and animal cholestatic disorders are associated with changes in hepatocyte cytoskeleton and tight junctions (TJs). These changes are usually secondary and nonspecific phenomena, both in intra- and extrahepatic cholestasis. Recently, missense mutations in TJ protein 2 (ZO-2) have
Juha Virman et al.
Anticancer research, 34(8), 4181-4187 (2014-07-31)
Claudins are tight junction proteins and their expression is often different in normal and corresponding tumor cells. In the present study, we determined how the expression of claudins 1-5 and 7 correlated to survival, grade and stage of patients with

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico