HPA010919

Anti-MGAT5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-GNT-V, Anti-KIAA0773, Anti-mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetyl-glucosaminyltransferase
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA010919

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: ALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQ
• UniProt-Hinterlegungsnummer: Q09328
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MGAT5(4249)

Beschreibung

Allgemeine Beschreibung

MGAT5 (mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetyl-glucosaminyltransferase) is a glycosyltransferase, which resides in the golgi apparatus. This gene maps to human chromosome 2q21 and has an open reading frame (ORF) of 2349bp. It is expressed ubiquitously, with the exception of skeletal muscle. Also its expression levels in brain are low.

Immunogen

mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

MGAT5 (mannosyl (α-1,6-)-glycoprotein β-1,6-N-acetyl-glucosaminyltransferase) catalyzes the addition of β1-6 N-acetylglucosamine branches on asparagine (N)-linked oligosaccharides (N-glycan), present on cell proteins. It catalyzes the transfer of N-acetylglucosamine (GlcNAc) to β1,6-linked mannosyl residue, at their C-6 position, within the trimannosyl core structure of N-glycans, which are complex in nature. This produces GlcNAc(β1,6)[GlcNAcβ1,2] mannose (Man) (α1,6). Dysregulation of this enzyme is associated with many cancers. The expression of MGAT5 in gastric cancer is related to metastasis, tumor grade and stage and prognosis. It is also down-regulated in ulcerative colitis (UC), which leads to disruption of N-glycosylation of T-cell receptor. Hence, MGAT5 plays a role in the pathogenesis of UC. The expression of MGAT5 is positively correlated with proliferation and metastasis of human hepatocellular carcinoma.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72105

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable