Direkt zum Inhalt
Merck

AV48088

Sigma-Aldrich

Anti-PAX8 antibody produced in rabbit

affinity isolated antibody

Synonym(e):

Anti-Paired box gene 8

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Form

buffered aqueous solution

Mol-Gew.

48 kDa

Speziesreaktivität

human, bovine, dog, mouse, rabbit, guinea pig, horse, rat

Konzentration

0.5 mg - 1 mg/mL

Methode(n)

immunohistochemistry: suitable
western blot: suitable

NCBI-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... PAX8(7849)

Allgemeine Beschreibung

PAX8 is a nephric transcription factor that is involved in the embryogenesis of thyroid gland, renal, and Mullerian system. It is expressed in several ovarian and kidney carcinomas, and can be a useful biomarker for these cancers for determining primary tumor sites.
Rabbit Anti-PAX8 antibody recognizes zebrafish, human, mouse, rat, and canine PAX8.

Immunogen

Synthetic peptide directed towards the N terminal region of human PAX8

Anwendung

Rabbit Anti-PAX8 antibody is suitable for western blot applications at a concentration of 0.25μg/ml.

Biochem./physiol. Wirkung

PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins which contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Sequenz

Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 3

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Prashant Kumar et al.
Genes & diseases, 9(1), 187-200 (2022-01-11)
TSC renal cystic disease is poorly understood and has no approved treatment. In a new principal cell-targeted murine model of Tsc cystic disease, the renal cystic epithelium is mostly composed of type A intercalated cells with an intact Tsc2 gene
David Tacha et al.
Applied immunohistochemistry & molecular morphology : AIMM, 19(4), 293-299 (2011-02-03)
PAX8 is a nephric-lineage transcription factor and is a crucial transcription factor for organogenesis of the thyroid gland, kidney, and Müllerian system. PAX8 is shown to be expressed in a high percentage of kidney and ovarian carcinomas. Limited information is
Anna R Laury et al.
The American journal of surgical pathology, 35(6), 816-826 (2011-05-10)
PAX8 is a paired-box gene important in embryogenesis of the thyroid, Müllerian, and renal/upper urinary tracts, and expression of PAX8 has been previously described in carcinomas from each of these sites. However, a large study including a wide variety of
Mary Toner et al.
Histopathology, 65(4), 501-507 (2014-03-07)
To describe a series of anaplastic thyroid carcinomas that mimicked primary head and neck squamous cell carcinoma (HNSCC) by virtue of both morphology and clinical presentation. Seven cases were identified in a 15-year period where a biopsy of an airway
Rachel A Davidowitz et al.
The Journal of clinical investigation, 124(6), 2611-2625 (2014-04-26)
Metastatic dissemination of ovarian tumors involves the invasion of tumor cell clusters into the mesothelial cell lining of peritoneal cavity organs; however, the tumor-specific factors that allow ovarian cancer cells to spread are unclear. We used an in vitro assay

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.