Passa al contenuto
Merck
Tutte le immagini(11)

Documenti fondamentali

WH0009804M1

Sigma-Aldrich

Monoclonal Anti-TOMM20 antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-KIAA0016, Anti-MAS20, Anti-MGC117367, Anti-MOM19, Anti-TOM20, Anti-translocase of outer mitochondrial membrane 20 homolog (yeast)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

4F3, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human, mouse, rat

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TOMM20(9804)

Categorie correlate

Descrizione generale

Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.

Immunogeno

TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Azioni biochim/fisiol

Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Motohisa Tada et al.
Cancer science, 101(5), 1261-1269 (2010-03-25)
We sought to identify genomic changes that could be useful for clinical application, focusing on chromosomal instability and using a high-density single nucleotide polymorphism (SNP) array. We analyzed 34 gastric cancer cell lines for areas of DNA that exhibited copy
Sinem K Saka et al.
Nature communications, 5, 3664-3664 (2014-04-11)
The isotopic composition of different materials can be imaged by secondary ion mass spectrometry. In biology, this method is mainly used to study cellular metabolism and turnover, by pulsing the cells with marker molecules such as amino acids labelled with
Sebastián A Riquelme et al.
European journal of immunology, 45(12), 3269-3288 (2015-10-16)
Heme-oxygenase 1 (HO-1) prevents T cell-mediated inflammatory disease by producing carbon monoxide (CO) and impairing DC immunogenicity. However, the cellular mechanisms causing this inhibition are unknown. Here, we show that CO impairs mitochondrial function in DCs by reducing both the
José R Blesa et al.
Gene, 391(1-2), 198-208 (2007-02-16)
TOMM20 is a subunit of the outer mitochondrial membrane translocase that plays a major role as a receptor of precursor proteins with N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factors 1 and 2 (NRF-1 and NRF-2) play an
E Schleiff et al.
Biochemistry, 37(38), 13052-13058 (1998-09-28)
hTom20 is an outer mitochondrial membrane receptor involved in protein translocation. The cytosolic domain (aa30-145) and selected truncated versions of this domain were overexpressed and purified to study the structure-function relationship of this protein. Our studies reveal that the secondary

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.