WH0007976M9

Monoclonal Anti-FZD3 antibody produced in mouse

clone 2H5, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-Fz3, Anti-frizzled homolog 3 (Drosophila), Anti-hFz3
• Numero MDL: MFCD06798445
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2H5, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_017412
• N° accesso UniProt: Q9NPG1
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FZD3(7976)

Descrizione

Descrizione generale

Frizzled class receptor 3 (FZD3) is a receptor with seven-transmembrane domains and it is expressed in human melanocytes. The gene encoding it is localized on human chromosome 8p21.1.

Immunogeno

FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

Azioni biochim/fisiol

Frizzled class receptor 3 (FZD3) modulates the growth of longitudinal axon tracts in the central nervous system. It mediates the dynamics of axon within the enteric, sympathetic and peripheral nervous systems. FZD3 regulates planar cell polarity. Abnormal FZD3 gene methylation causes chromatin structure modifications, associated with congenital hydrocephalus. Mutation in FZD3 gene is associated with Hirschsprung disease, a birth defect lacking the intrinsic ganglion cells of the lower intestine.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)