Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

WH0004222M1

Sigma-Aldrich

Monoclonal Anti-MEOX1 antibody produced in mouse

clone 1A10, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-MOX1, Anti-mesenchyme homeobox 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.43

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1A10, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MEOX1(4222)

Descrizione generale

MEOX1 (mesenchyme homeobox 1) gene codes for homeobox proteins that are located on many mesodermal structures. It has an N terminal, middle, a C terminal domain, as well as a homeo domain. This gene is located on human chromosome 17q21.31.
This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

Immunogeno

MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS

Azioni biochim/fisiol

MEOX1 (mesenchyme homeobox 1) is essential in axial skeleton and limb muscle development. Mutation in MEOX1 gene results in Klippel-feil syndrome subtype.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Mutations in MEOX1, encoding mesenchyme homeobox 1, cause Klippel-Feil anomaly
Mohamed JY, et al.
American Journal of Human Genetics, 92(1), 157-161 (2013)
Homeodomain proteins Mox1 and Mox2 associate with Pax1 and Pax3 transcription factors
Stamataki D, et al.
Febs Letters, 499(3), 274-278 (2001)
Mutation in MEOX1 gene causes a recessive Klippel-Feil syndrome subtype
Bayrakli F, et al.
BMC Genetics, 14(1), 95-95 (2013)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.