WH0004222M1

Monoclonal Anti-MEOX1 antibody produced in mouse

clone 1A10, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-MOX1, Anti-mesenchyme homeobox 1
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1A10, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_004527
• N° accesso UniProt: P50221
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MEOX1(4222)

Descrizione

Descrizione generale

MEOX1 (mesenchyme homeobox 1) gene codes for homeobox proteins that are located on many mesodermal structures. It has an N terminal, middle, a C terminal domain, as well as a homeo domain. This gene is located on human chromosome 17q21.31.

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

Immunogeno

MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS

Azioni biochim/fisiol

MEOX1 (mesenchyme homeobox 1) is essential in axial skeleton and limb muscle development. Mutation in MEOX1 gene results in Klippel-feil syndrome subtype.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)