Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

WH0003848M1

Sigma-Aldrich

Monoclonal Anti-KRT1 antibody produced in mouse

clone 2A7, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-CK1, Anti-EHK1, Anti-K1, Anti-KRT1A, Anti-keratin 1 (epidermolytic hyperkeratosis)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Numero MDL:
MFCD04040315
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2A7, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

NM_006121

N° accesso UniProt

P04264

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KRT1(3848)

Descrizione generale

Keratin 1 (KRT1) is a cytoplasmic intermediate filament protein, that is expressed in the basal layer of the epidermis. This gene is located on human chromosome 12q13.
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. (provided by RefSeq)

Immunogeno

KRT1 (NP_006112, 387 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE

Azioni biochim/fisiol

Keratin 1 (KRT1) helps to maintain skin integrity and participates in inflammatory response. It plays an important role in the differentiation and function of keratinocytes. Since KRT1 is one of the important cytoskeleton filament, it extends mechanical support and participates in additional activities in epithelial cells.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Allele-specific KRT1 expression is a complex trait
Tao H, et al.
PLoS Genetics, 2(6), e93-e93 (2006)
Polymorphism of keratin 1 associates with systemic lupus erythematosus and systemic sclerosis in a south Chinese population
Luo W, et al.
PLoS ONE, 12(10) (2017)
Linkage of the gene for the triple A syndrome to chromosome 12q13 near the type II keratin gene cluster
Weber A, et al.
Human Molecular Genetics, 5(12), 2061-2066 (1996)
Keith A Choate et al.
The Journal of clinical investigation, 125(4), 1703-1707 (2015-03-17)
Widespread reversion of genetic disease is rare; however, such events are particularly evident in some skin disorders in which normal clones develop on a background of affected skin. We previously demonstrated that mutations in keratin 10 (KRT10) cause ichthyosis with

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.