SAB5702074

Anti-ErbB4/HER4 Antibody, clone 8E5D0, Rabbit Monoclonal

• Sinonimo/i: ALS19,HER4,p180erbB4,ERBB4,HER4/ErbB4
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: 8E5D0, monoclonal
• application: WB
• Reattività contro le specie: rat, mouse
• tecniche: western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 8E5D0, monoclonal
• Stato: liquid
• PM: 180 kDa
• Reattività contro le specie: rat, mouse
• Concentrazione: 0.25 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: DEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
• N° accesso UniProt: Q15303
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ERBB4(2066)

Descrizione

Descrizione generale

This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1200-1308 of human ErbB4/HER4 (Q15303).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1