SAB2108827

Anti-DAG1 antibody produced in rabbit biotin conjugted

affinity isolated antibody

• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Coniugato: biotin conjugate
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 27 kDa
• Reattività contro le specie (prevista in base all’omologia): zebrafish, bovine, guinea pig, rabbit, canine, horse, pig, mouse, human
• Concentrazione: 0.5 mg/mL
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• N° accesso NCBI: NM_004393
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DAG1(1605)

Descrizione

Descrizione generale

This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.

Immunogeno

Synthetic peptide directed towards the middle region of human alpha-DAG1

Sequenza

Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable