SAB2108447

Anti-BAX

IgG fraction of antiserum

• Sinonimo/i: Anti-CLECSF10
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 21 kDa
• Reattività contro le specie: bovine, human, dog, pig
• Concentrazione: 0.5-1 mg/mL
• tecniche: immunoblotting: suitable; immunohistochemistry: suitable
• Numero d’accesso: NM_138761
• N° accesso UniProt: Q07812
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BAX(581)

Descrizione

Descrizione generale

B-cell lymphoma 2 associated X (BAX), also known as CLECSF10 (C-type lectin superfamily member 10), is located on human chromosome 19q13. BAX is a proapoptotic protein and is a member of Bcl-2 protein family.

Immunogeno

Synthetic peptide directed towards the N terminal region of human BAX

Applicazioni

Anti-BAX has been used in Western blotting.

Azioni biochim/fisiol

B-cell lymphoma 2 associated X (BAX) promotes cell death and plays a vital role in regulation of apoptosis. BAX gene may act as a negative regulator of autophagy in CRC (colorectal cancer) development.

Sequenza

Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable