Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

SAB2108342

Sigma-Aldrich

Anti-SGK1 antibody produced in rabbit

affinity isolated antibody

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41
Coniugato:
unconjugated
application:
IHC
Clone:
polyclonal
Reattività contro le specie:
guinea pig, rabbit, bovine, human, mouse, rat, dog, horse
citations:
4
tecniche:
immunoblotting: suitable
immunohistochemistry: suitable

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

49kDa

Reattività contro le specie

guinea pig, rabbit, bovine, human, mouse, rat, dog, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunoblotting: suitable
immunohistochemistry: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SGK1(6446)

Descrizione generale

SGK1 (serum/glucocorticoid regulated kinase 1) codes for a serine/threonine kinase and it is structurally and functionally homologous to kinases of AKT (protein kinase B) family. SGK1 is ubiquitously expressed in all tissues and is predominant in kidney. The SKG1 gene is mapped to human chromosome 6q23.2.

Immunogeno

Synthetic peptide directed towards the N terminal region of human SGK1

Azioni biochim/fisiol

The SGK1 (serum/glucocorticoid regulated kinase 1) gene is associated with a number of pathophysiological processes such as autophagy, ion transport, proliferation, metabolic, inflammation, syndrome and endoplasmic reticulum stress. Cellular dehydration, increased extracellular salt concentration, hormones such as glucocorticoids, mineralocorticoids, transforming growth factor β and mediators (cytokines) such as interleukin -6, stimulates SGK1 action. SGK1 gene expression is regulated by cellular signals involving cytosolic Ca2+, cyclic AMP (adenosine monophosphate), stress-activated protein kinase (SAPK2 (serine/threonine-protein kinase 2), p38 kinase), protein kinase C. Also, insulin and insulin-like growth factor, ERK (extracellular signal-regulated kinase) 1/2, and hepatic growth factor induces SGK1 transcription. Upregulation of SGK1 is observed in diabetes, liver cirrhosis, glomerulonephritis, dialysis and several tumors.

Sequenza

Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

SGK1 inhibits PM2. 5-induced apoptosis and oxidative stress in human lung alveolar epithelial A549 cells.
Li J, et al.
Biochemical and Biophysical Research Communications, 496(4), 1291-1295 (2018)
Single nucleotide polymorphism microarray analysis in cortisol-secreting adrenocortical adenomas identifies new candidate genes and pathways.
Ronchi C L, et al.
Neoplasia, 14(3), 206-218 (2012)
Associations of the Serum/Glucocorticoid Regulated Kinase Genes With BP Changes and Hypertension Incidence: The Gensalt Study.
Zhang D, et al.
American Journal of Hypertension, 30(1), 95-101 (2016)
Lnc-SGK1 induced by Helicobacter pylori infection and highsalt diet promote Th2 and Th17 differentiation in human gastric cancer by SGK1/Jun B signaling.
Yao Y, et al.
Oncotarget, 7(15), 20549-20549 (2016)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.