Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2104747

Sigma-Aldrich

Anti-METTL3 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-M6A, Anti-MGC4336, Anti-MT-A70, Anti-Spo8

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

64 kDa

Reattività contro le specie

human, mouse, rabbit, horse, rat, guinea pig, dog, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... METTL3(56339)

Descrizione generale

Methyltransferase like 3 (METTL3), an RNA methyltransferase, is a member of the class I methyltransferase (MTase) family and contains the MTase domain. The METTL3 gene is mapped to human chromosome 14q11.2.

Immunogeno

Synthetic peptide directed towards the middle region of human METTL3

Applicazioni

Anti-METTL3 antibody produced in rabbit has been used in western blotting.

Azioni biochim/fisiol

Methyltransferase like 3 (METTL3) is part of methyltransferase systems that mediates the m6methyladenosine modifications. It exists as a heterodimeric complex with METTL14. An elevated expression of METTL3 is observed in clear cell renal cell carcinoma and rheumatoid arthritis (RA). Mutations in the METTL3 gene are implicated in autoimmune thyroid disease (AITD) and neuroblastoma. It may function as a tumor-suppresser in colorectal cancer.

Sequenza

Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Xiang Wang et al.
Nature, 534(7608), 575-578 (2016-06-10)
Chemical modifications of RNA have essential roles in a vast range of cellular processes. N(6)-methyladenosine (m(6)A) is an abundant internal modification in messenger RNA and long non-coding RNA that can be dynamically added and removed by RNA methyltransferases (MTases) and
Jun Bian et al.
Journal of cellular and molecular medicine, 24(16), 9280-9286 (2020-07-03)
Neuroblastoma ranks as the most commonly seen and deadly solid tumour in infancy. The aberrant activity of m6 A-RNA methyltransferase METTL3 is involved in human cancers. Therefore, functional genetic variants in the METTL3 gene may contribute to neuroblastoma risk. In
Wenhui Zheng et al.
Frontiers in oncology, 9, 1403-1403 (2020-01-11)
Methyltransferase-like 3 (METTL3), a predominantly catalytic enzyme in the N6-methyladenosine (m6A) methyltransferase system, is dysregulated and plays a dual role (oncogene or tumor suppressor) in different human cancers. The expression and pro- or anticancer role of METTL3 in different cancers
Fang Yu et al.
Nucleic acids research, 49(10), 5779-5797 (2021-05-29)
Faithful genome integrity maintenance plays an essential role in cell survival. Here, we identify the RNA demethylase ALKBH5 as a key regulator that protects cells from DNA damage and apoptosis during reactive oxygen species (ROS)-induced stress. We find that ROS

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.